The domain within your query sequence starts at position 21 and ends at position 138; the E-value for the DUF2353 domain shown below is 1.5e-28.
KRKLESKKEALLILSKELDTCQQERDQYKLMANQLRERHQSLKKKYRELIDGDPSLPPEK RKQANLAQLLRESQDRTKHLGEEIKELRQRLGEVQGDNKGRFRSRKMKAAQLLRHWQS
DUF2353 |
---|
PFAM accession number: | PF09789 |
---|---|
Interpro abstract (IPR019179): | Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2353