The domain within your query sequence starts at position 28 and ends at position 120; the E-value for the DUF2367 domain shown below is 1.6e-37.
LGVLRGLAMASTVQEAGIPTSHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEYCFT CLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVF
DUF2367 |
---|
PFAM accession number: | PF10164 |
---|---|
Interpro abstract (IPR019317): | This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3) [ (PUBMED:11290423) ]. Their function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2367