The domain within your query sequence starts at position 54 and ends at position 170; the E-value for the DUF2370 domain shown below is 1.3e-11.

DYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIG
NDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYF

DUF2370

DUF2370
PFAM accession number:PF10176
Interpro abstract (IPR019325):

Proteins in this entry include the human NEDD4 family-interacting protein 1/2 (Ndfip1 and Ndfip2) and the yeast Bsd2 metal homeostatis proteins.

Ndfip1 and Ndfip2 are endosomal membrane proteins that bind to and activate members of the Nedd4 family of E3 ubiquitin ligases [(PUBMED:19343052), (PUBMED:20534535)]. Ndfip1 plays a role in regulating metal transport in human neurons [(PUBMED:19706893)].

Bsd2 is required for the targeting of several proteins into the MVB (multivesicular body) pathway [(PUBMED:17429078)]. It prevents metal hyperaccumulation by exerting negative control over the Smf1 and Smf2 metal transport systems [(PUBMED:9115231)].

GO process:vacuolar transport (GO:0007034), metal ion transport (GO:0030001)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2370