The domain within your query sequence starts at position 14 and ends at position 92; the E-value for the DUF2371 domain shown below is 8.8e-13.
SPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGY WPGRASHTHAPRTGRAHGP
DUF2371 |
---|
PFAM accession number: | PF10177 |
---|---|
Interpro abstract (IPR018787): | This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2371