The domain within your query sequence starts at position 103 and ends at position 165; the E-value for the DUF2373 domain shown below is 3e-26.

EYLQGWAQKQESWRFQKTRQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKA
EAL

DUF2373

DUF2373
PFAM accession number:PF10180
Interpro abstract (IPR019327):

This is a conserved family of proteins found from fungi to humans. The function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2373