The domain within your query sequence starts at position 938 and ends at position 1239; the E-value for the DUF2428 domain shown below is 1.6e-93.

PLLGRLLLLSYRLSTVVAPVIQSSSPEGLIPVDTDSASASRLQLILNEIQPRDTNDYFNH
TKILKECDSFDLEDLSTSVSNIDSSAEVKGKEEKACDVTAQMVLACCWRSMKEVALLLGT
LCQLLPVQPGPESSNVFLTVQQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEILNRC
SNVSLQKLPEQWLRSVLEEIKGSDPSSKLCATRRSAGIPFYIQALLASEPKKSRMDLLKI
TMRELISLALSADDSKGRVPQVHALNILRALFRDTRLGENIIPYVAGGAKAAILGFTSPV
WA

DUF2428

DUF2428
PFAM accession number:PF10350
Interpro abstract (IPR019442):

This domain is found in a family of proteins of unknown function that are conserved from plants to humans. Several of these proteins have been annotated as being HEAT repeat-containing proteins while others are designated as death-receptor interacting proteins, but neither of these has yet been confirmed. Aberrations in the genes encoding these proteins have been observed in benign thyroid adenomas [(PUBMED:12955091)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2428