The domain within your query sequence starts at position 3 and ends at position 82; the E-value for the DUF2439 domain shown below is 3.5e-22.
CQEFIVLYTHQKMKKSKVWQDGVLKITHLGNKAILYDDKGACLESLFLKCLEVKPGDDLE SERYLITVEEAKAVGSRAVE
DUF2439 |
![]() |
---|
PFAM accession number: | PF10382 |
---|---|
Interpro abstract (IPR018838): | This domain is found at the N-terminal of DNA repair and recombination protein Rdh54 from Saccharomyces cerevisiae. Rdh54 is a member of the Swi2/Snf2 protein family that is needed for mitotic and meiotic interhomologue recombination and DNA repair [ (PUBMED:16831867) ]. Proteins containing this domain also include ZGRF1 from mammals. The funciton of ZGRF1 is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2439