The domain within your query sequence starts at position 191 and ends at position 389; the E-value for the DUF2448 domain shown below is 3.1e-96.

FRRREADQAHGQSFSSSAVKAPFQVILLRALAFLACAFLLFTTLYGPSEPFTPGAALPPA
LPPGGNSSAASDNTTSQAEGWQQLLGLLPEHATEKLHEAWAFGQSHQTSIVAVGLLTCLL
AMLLAGRIRLRRIDAFSTCLWALLLGLHLAEHYLQAASPGWLDTLKFSTTSLCCLVGFTA
AVATRKSTGPRRFRPRRYF

DUF2448

DUF2448
PFAM accession number:PF10476
Interpro abstract (IPR018861):

TMEM201, also known as SAMP1, is a RanGTP binding transmembrane protein found in the inner nuclear membrane [(PUBMED:27541860)]. It is functionally associated with the LINC complex protein Sun1 and proteins of the A-type lamina network [(PUBMED:21610090)].

GO component:integral component of nuclear inner membrane (GO:0005639)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2448