The domain within your query sequence starts at position 191 and ends at position 392; the E-value for the DUF2448 domain shown below is 4.4e-102.
FRRREADQAHGQSFSSSAVKAPFQVILLRALAFLACAFLLFTTLYGPSEPFTPGAALPPA LPPGGNSSAASDNTTSQAEGWQQLLGLLPEHATEKLHEAWAFGQSHQTSIVAVGLLTCLL AMLLAGRIRLRRIDAFSTCLWALLLGLHLAEHYLQAASPGWLDTLKFSTTSLCCLVGFTA AVATRKSTGPRRFRPRRYFSGD
DUF2448 |
---|
PFAM accession number: | PF10476 |
---|---|
Interpro abstract (IPR018861): | TMEM201, also known as SAMP1, is a RanGTP binding transmembrane protein found in the inner nuclear membrane [ (PUBMED:27541860) ]. It is functionally associated with the LINC complex protein Sun1 and proteins of the A-type lamina network [ (PUBMED:21610090) ]. This entry represents the C-terminal domain of TMEM201. |
GO component: | integral component of nuclear inner membrane (GO:0005639) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2448