SMART: Pfam domain DUF2451

The domain within your query sequence starts at position 723 and ends at position 929; the E-value for the DUF2451 domain shown below is 1.1e-90.

LYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPIYW
IVAGKAIDYEQMLLLMMNVKWDVKEIMSQHNIYVDALLKEFEQFNKRLNEVSKRVRIPLP
VSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEF
VETYIKAYYLTENDMERWIKEHRIFSV

DUF2451

PFAM accession number:	PF10474
Interpro abstract (IPR019514):	The function of this domain is not known, but it is found at the C terminus of syndetin (VPS50), a unique component of the endosome-associated retrograde protein (EARP) complex. The EARP complex otherwise shares four of its five subunits with the Golgi-associated retrograde protein (GARP) complex. The EARP complex is localized to recycling endosomes where it acts as a tethering complex for recycling of plasma membrane receptors [ (PUBMED:25799061) ].

PFAM accession number:

PF10474

Interpro abstract (IPR019514):

The function of this domain is not known, but it is found at the C terminus of syndetin (VPS50), a unique component of the endosome-associated retrograde protein (EARP) complex. The EARP complex otherwise shares four of its five subunits with the Golgi-associated retrograde protein (GARP) complex. The EARP complex is localized to recycling endosomes where it acts as a tethering complex for recycling of plasma membrane receptors [ (PUBMED:25799061) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2451