The domain within your query sequence starts at position 27 and ends at position 182; the E-value for the DUF2452 domain shown below is 2.2e-78.
GALVELTPTPGGLALVSPYHTHRVGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQ HLQEQARKVLEDARRDADLHHAACNMVKKPGNIYYLYQRESGQQYFSIISPEEWGTGCPH DFLGAYKLQHDMSWTPYEDVEKQDAKIGMMDKLLSQ
DUF2452 |
---|
PFAM accession number: | PF10504 |
---|---|
Interpro abstract (IPR019534): | This entry contains proteins that have no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2452