The domain within your query sequence starts at position 46 and ends at position 297; the E-value for the DUF2464 domain shown below is 1.7e-87.
DPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHL GNVLVDMKLIDVKDTLPVGFIPIQETVDTQEVVFRKKRLCIKFIPRDSTEAAICDIRIMG RTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSASSTPAPNLPRHISLTL PATFRGRNNTSTDYEYQLSNLYAISAMDGVPFMISEKFSCIPESMQPFDLLGITIKSLAE IEKEYEYSFRTE
DUF2464 |
---|
PFAM accession number: | PF10240 |
---|---|
Interpro abstract (IPR018798): | MVB12A (also known as CFBP) and MVB12B are subunits of the ESCRT-I complex, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle [ (PUBMED:20654576) (PUBMED:24284069) ]. MVB12A plays a key role in the ligand-mediated internalization and down-regulation of the EGF receptor [ (PUBMED:16895919) ]. |
GO component: | ESCRT I complex (GO:0000813) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2464