The domain within your query sequence starts at position 211 and ends at position 242; the E-value for the DUF2465 domain shown below is 6.9e-13.

AEVLMGDVPDRGGRPSELEAPMPTWKSRREDG

DUF2465

DUF2465
PFAM accession number:PF10239
Interpro abstract (IPR018797):

FAM98A, B and C are glycine-rich proteins found from worms to humans. FAM98A contains a tubulin-binding calponin homology domain. It interacts with PLEKHM1 and functions in lysosome positioning in osteoclasts [(PUBMED:27777970)]. FAM98A and FAM98B are included in a novel complex with DDX1 and C14orf166 and are involved in colorectal cancer progression [(PUBMED:28040436)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2465