The domain within your query sequence starts at position 15 and ends at position 76; the E-value for the DUF2475 domain shown below is 1.3e-20.

NPHYIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLAWPPAHRTLLPPIQSPRSPVISK
GR

DUF2475

DUF2475
PFAM accession number:PF10629
Interpro abstract (IPR018902):

This entry represents both UPF0573 and UPF0605 families. Both these families of proteins have no known function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2475