The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the DUF2615 domain shown below is 1.2e-40.
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSSDSGISITVILMAW MVIAMLLFLLRPPNLRGSSLPGKPSSPHSAP
DUF2615 |
 |
|---|
| PFAM accession number: | PF11027 |
|---|---|
| Interpro abstract (IPR020309): | This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2615