The domain within your query sequence starts at position 1 and ends at position 118; the E-value for the DUF2678 domain shown below is 2.4e-73.
MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTTLLILVTLISAFVFPQLPPKPL NIFFAVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSIIMLCICANLYFHDVGR
DUF2678 |
 |
|---|
| PFAM accession number: | PF10856 |
|---|---|
| Interpro abstract (IPR022564): | This family of proteins has no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2678