The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the DUF2723 domain shown below is 4.6e-9.
MALTVRFEEATAAKERSKIAAIGAFSCGLSLCNQHTIVLYILCIIPWILFRLLKEKELTL S
DUF2723 |
---|
PFAM accession number: | PF11028 |
---|---|
Interpro abstract (IPR021280): | This family is conserved in bacteria. The function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2723