The domain within your query sequence starts at position 120 and ends at position 277; the E-value for the DUF3314 domain shown below is 3.8e-75.
MYASFGFVDLEETNPLSISCFFCGRFSISPSHDVSIFRYCTPAAYTASHFPRYLYKKMRW NLETTTEASSQGADSHVDYYFLCYRDTWEDAGQGPANSCPQIQKLWSIGRWMPLGPAEDD LDSWILCPQPPGDYQQLLTIGFEEPSHVLATDLLVQIL
DUF3314 |
---|
PFAM accession number: | PF11771 |
---|---|
Interpro abstract (IPR021748): | This small family contains human, mouse and fish members but the function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3314