The domain within your query sequence starts at position 509 and ends at position 673; the E-value for the DUF3337 domain shown below is 1.1e-49.

VPPHTPVIFGEAGGRTLFRLLCRDSGGETEAMLLNETVPQWVIDITVDKNMPKFNKIPFY
LQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPEQEKEE
DIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQ

DUF3337

DUF3337
PFAM accession number:PF11816
Interpro abstract (IPR021772):

This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. This presumed domain is typically between 285 to 342 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3337