The domain within your query sequence starts at position 1 and ends at position 132; the E-value for the DUF3338 domain shown below is 6.8e-58.

MESKDEVSDSDSGIILQSGPDSPVSPMKELTNAVRKQQRALEARLEACLEELRRLCLREA
ELTGTLPAEYPLKPGEKAPKVRRRIGAAYKLDEWALHREDPLSSLERQLALQLQITEAAR
RLCAEENLSRQA

DUF3338

DUF3338
PFAM accession number:PF11819
Interpro abstract (IPR021774):

This domain is functionally uncharacterised. It is found in eukaryotes. This presumed domain is about 130 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3338