The domain within your query sequence starts at position 147 and ends at position 449; the E-value for the DUF3342 domain shown below is 1e-106.

MVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIK
YVKRNTKESKDCEIPALEPGNVISILISSEFLKMDSLVEQCIQYCHKNMNAIVAAPCNMN
CINANLLTRIADLFTHNEIDDLKDKKDKFRSKLFCKKIERLFDPEYSNPDSRNNAATLYR
CCLCKKLLTRETERRIPCIPGKINVDRHGNIIYIHIRDKTWDVHEYLNSLFEELKSWRDV
YWRLWGTVNWLTCSRCYQAFLCIEFSHCQYHSEVVVYSSTVNSLNTVGTGIYPCCNQKVL
RFD

DUF3342

DUF3342
PFAM accession number:PF11822
Interpro abstract (IPR021777):

This family of proteins are functionally uncharacterised. This family is found in bacteria. This presumed domain is typically between 170 to 303 amino acids in length. The N-terminal half of this family is a BTB-like domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3342