The domain within your query sequence starts at position 684 and ends at position 739; the E-value for the DUF3350 domain shown below is 4e-29.
ELPPRSPLEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQ
DUF3350 |
---|
PFAM accession number: | PF11830 |
---|---|
Interpro abstract (IPR021785): | This domain is functionally uncharacterised. This domain is found in eukaryotes. This presumed domain is typically between 50 to 64 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3350