The domain within your query sequence starts at position 777 and ends at position 832; the E-value for the DUF3350 domain shown below is 2.5e-25.

ELPPRSPLEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQ

DUF3350

 DUF3350
PFAM accession number:PF11830
Interpro abstract (IPR021785):

This domain is functionally uncharacterised. This domain is found in eukaryotes. This presumed domain is typically between 50 to 64 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3350