The domain within your query sequence starts at position 586 and ends at position 657; the E-value for the DUF3377 domain shown below is 1.2e-32.
DSKEENAGDKDEGSRVVVQMEEVVRTVNVVMVLVPLLLLLCILGLAFALVQMQRKGAPRM LLYCKRSLQEWV
DUF3377 |
---|
PFAM accession number: | PF11857 |
---|---|
Interpro abstract (IPR021805): | This domain is functionally uncharacterised and found at the C terminus of peptidases belonging to MEROPS peptidase family M10A, membrane-type matrix metallopeptidases (clan MA). |
GO function: | metalloendopeptidase activity (GO:0004222) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3377