The domain within your query sequence starts at position 231 and ends at position 398; the E-value for the DUF3381 domain shown below is 1.3e-48.

VTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEISIDDEELAQHPATTEDI
RVCCQDIKVLGRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSEEEEEGDEEEAVAE
TKQAPEEEEEREEEQLNRTLAEMKAQEVAELKRKKKKLLREQRKQRER

DUF3381

DUF3381
PFAM accession number:PF11861
Interpro abstract (IPR024576):

This uncharacterised domain is found in eukaryotic rRNA methyltransferases like yeast Spb1 and mammalian homologue Ftsj3. Spb1 is required for proper assembly of pre-ribosomal particles during the biogenesis of the 60S ribosomal subunit [(PUBMED:10556316), (PUBMED:15546625)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3381