The domain within your query sequence starts at position 54 and ends at position 470; the E-value for the DUF3384 domain shown below is 4e-103.

LNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQG
DRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLS
SEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPA
ESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLR
GAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKEL
QAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVES
YADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLS

DUF3384

DUF3384
PFAM accession number:PF11864
Interpro abstract (IPR024584): This entry represents the N-terminal domain of tuberin which is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3384