The domain within your query sequence starts at position 426 and ends at position 520; the E-value for the DUF3432 domain shown below is 4.9e-33.
KSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSV ATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSD
DUF3432 |
![]() |
---|
PFAM accession number: | PF11914 |
---|---|
Interpro abstract (IPR021839): | EGR1 is a transcriptional regulator that binds specifically to 9-bp target sequences containing two CpG sites that can potentially be methylated at four cytosine bases [ (PUBMED:25999311) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3432