SMART: Pfam domain DUF3437

The domain within your query sequence starts at position 1756 and ends at position 1843; the E-value for the DUF3437 domain shown below is 5.3e-39.

LVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHD
NWQEHKQQFTDDQLLVLTDLLVSPCYYA

DUF3437

PFAM accession number:	PF11919
Interpro abstract (IPR021843):	This domain is typically between 142 to 163 amino acids in length is found at the C terminus of activator complex subunit 4 (gene name PSME4, PA2000 or BLM10), a component of the 19S cap complex of the eukaryotic 26S proteasome. The tertiary structure of BLM10 from Saccharomyces cerevisiae has been solved, showing that the C terminus is important for helping to form the BLM10 cap that covers the entry pore of the proteasome, restricting access for potential substrates. The C-terminal residues bind in the pocket between proteasome subunits alpha5 and alpha6, in a similar site to where the C-termini of the ATPases of the 19S proteasomal cap also bind [ (PUBMED:20227375) ].

PFAM accession number:

PF11919

Interpro abstract (IPR021843):

This domain is typically between 142 to 163 amino acids in length is found at the C terminus of activator complex subunit 4 (gene name PSME4, PA2000 or BLM10), a component of the 19S cap complex of the eukaryotic 26S proteasome. The tertiary structure of BLM10 from Saccharomyces cerevisiae has been solved, showing that the C terminus is important for helping to form the BLM10 cap that covers the entry pore of the proteasome, restricting access for potential substrates. The C-terminal residues bind in the pocket between proteasome subunits alpha5 and alpha6, in a similar site to where the C-termini of the ATPases of the 19S proteasomal cap also bind [ (PUBMED:20227375) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3437