The domain within your query sequence starts at position 117 and ends at position 230; the E-value for the DUF3453 domain shown below is 1.1e-35.

LLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISDLQEACWDMVSSMAGEIILLLDSDN
DGIRTHAIKFVEGLIVTLSPRMADSEVPRRQEHDISLDRIPRDHPYIQYNSFMY

DUF3453

DUF3453
PFAM accession number:PF11935
Interpro abstract (IPR032460):

This domain can be found in the symplekin protein from animals and Pta1 protein from budding yeasts. This domain is typically between 239 to 261 amino acids in length.

Symplekin is a scaffold protein that functions as a component of a multimolecular complex involved in histone mRNA 3'-end processing [(PUBMED:18042462), (PUBMED:19450530)].

Pta1 is involved in pre-tRNA processing. Pta1 is a subunit of the cleavage and polyadenylation factor (CPF), which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB [(PUBMED:12819204)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3453