The domain within your query sequence starts at position 827 and ends at position 911; the E-value for the DUF3481 domain shown below is 2.3e-25.

TSGAGDPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCT
TLENYNFELYDGLKHKVKINHQKCC

DUF3481

DUF3481
PFAM accession number:PF11980
Interpro abstract (IPR022579):

This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptors. There are two completely conserved residues (Y and E) that may be functionally important.

Neuropilins are essential multifunctional vertebrate cell surface receptors [ (PUBMED:23116416) ]. They function as receptors for axon guidance factor semaphorin class 3 (Sema3), vascular endothelial growth factor (VEGF) and placenta growth factor-2 (PLGF-2).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3481