The domain within your query sequence starts at position 986 and ends at position 1108; the E-value for the DUF3498 domain shown below is 3.3e-61.

MHKQDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKD
IQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLK
ERY

DUF3498

DUF3498
PFAM accession number:PF12004
Interpro abstract (IPR021887):

This presumed domain can be found at the C terminus of Ras GTPase-activating proteins (RasGAPs). This domain is typically between 433 to 538 amino acids in length. It is found associated with the RasGAP domain (IPR001936) and the C2 domain (IPR000008). This domain has two conserved sequence motifs: DLQ and PLSFQNP.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3498