The domain within your query sequence starts at position 370 and ends at position 555; the E-value for the DUF3513 domain shown below is 9.2e-53.

EYEGIPMAEEYDYVHLKGVDTAQGSRPLDKAFPVDPELLERGLAERKEALSPEEPLVLST
GDLQLLHFYAGQCQSHYSALQAAVAALVASTQANQPPCLFVPHGKRVVVAAHRLVFVGDT
LGRLAASAALRAQVGAAGTMLAQTLRATVLAVKGAALGYPSDTAVQEMARCVAELAGQAL
RFTTLL

DUF3513

DUF3513
PFAM accession number:PF12026
Interpro abstract (IPR021901): This domain is found in the C terminus of the CAS family members. The CAS (Crk-Associated Substrate) protein family is a group of scaffolding proteins that play important modulatory roles in both normal and pathological cell growth regulation. They contain an N-terminal Src homology 3 (SH3) domain and a substrate domain (SD). The SD contains a large number of YxxP motifs, which when phosphorylated by Src-family kinases provide canonical binding sites for proteins containing SH2 domains such as Crk, Crk-L, CRKII [(PUBMED:19937461)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3513