The domain within your query sequence starts at position 541 and ends at position 725; the E-value for the DUF3522 domain shown below is 1e-50.

QQRAAALLLTLSNLMFLAPIAISLHRSFLVEASVYFYTMFFSTFYHACDQPGEAVLCILS
YDTLQYCDFLGSGASTWVTILCMARLKTILKQVLLVLGTLVIAMSLQMDRRGIWNLMGPC
VFAFVIMASMWIYRCGHRGQCYPTSWQRWVFYLLPGISMASVGIAMYTSMMTSDNYYYTH
SIWHI

DUF3522

DUF3522
PFAM accession number:PF12036
Interpro abstract (IPR021910):

Proteins in this family include PGAP6 (also known as TMEM8A), NGX6 (also known as TMEM8B) and myomaker (also known as TMEM8C). TMEM8C is embedded in the plasma membrane with seven membrane-spanning regions and a required intracellular C-terminal tail. It is essential for myoblast fusion and sufficient to promote fusion of fibroblasts with muscle cells [(PUBMED:26858401)]. TMEM8A and TMEM8B has no fusogenic activity. TMEM8A is a GPI-specific phospholipase A2 involved in Nodal signaling modulation through CRIPTO shedding [(PUBMED:27881714)]. TMEM8B plays a role in cell adhesion modulation in nasopharyngeal carcinoma cells [(PUBMED:15498789)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3522