The domain within your query sequence starts at position 2 and ends at position 167; the E-value for the DUF3524 domain shown below is 1.3e-74.
SIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYRT LFASSVLNLTELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSCLVADV VVFNSSFNMESFLTSIGKFLKLIPDHRPKDLESIIRPKCQVIYFPI
DUF3524 |
---|
PFAM accession number: | PF12038 |
---|---|
Interpro abstract (IPR022701): | This domain is functionally uncharacterised and is found in bacteria and eukaryotes. It is about 170 amino acids in length and is found associated with . Two conserved sequence motifs are found within this entry: HENQ and FNS. There is also a single completely conserved residue S that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3524