The domain within your query sequence starts at position 26 and ends at position 168; the E-value for the DUF3528 domain shown below is 4.7e-67.
PDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYS AEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFF ETAYGTPENLASSDYPGDKNAEK
DUF3528 |
---|
PFAM accession number: | PF12045 |
---|---|
Interpro abstract (IPR021918): | This domain of unknown function is found at the N terminus of some Homeobox proteins belonging to the ABD-B family. It is found in association with . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3528