The domain within your query sequence starts at position 42 and ends at position 178; the E-value for the DUF3528 domain shown below is 5.2e-52.

PEFSTVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMH
RECLPPSTVTEILMKNEGSYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCG
GGDAPAEPPCSGKGEAK

DUF3528

DUF3528
PFAM accession number:PF12045
Interpro abstract (IPR021918):

This domain of unknown function is found at the N terminus of some Homeobox proteins belonging to the ABD-B family. It is found in association with.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3528