The domain within your query sequence starts at position 585 and ends at position 1051; the E-value for the DUF3535 domain shown below is 1.1e-133.

VWMELLSKASVQYLVAAACPWMSAWLCLMMQPSHLPIDLNMLLEVKARAKEKTGGKVRQG
QIQNKEVLQEYIAGADTIMEDPATRDFVVMRARMMAAKLLGALCCYICDPSVNMVNQEIK
PADSLGQLLLFYLNSKSALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYD
EIAVPFTRMQNECKQFISSLADAHIEVGNRVNNNVLTIDQANDLVTTIFNEVTSTFDLNP
QVLQQLDSKRHQVQMTVAETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETI
KKEENTLVQNYAAQYIAKLLQQCTTRTPCPNSKVIKNLCSSLCVDPYLTPCVTCPVPTQS
GQENSKGSNSEKDGMHHTVTKHRGIITLYRHQKAAFAITSRRGPIPKAIKAQIADLPAGS
SGTILVELDEGQKPYLVQRRGAEFALTTIVKHFGAEMAVKLPHLWDA

DUF3535

DUF3535
PFAM accession number:PF12054
Interpro abstract (IPR022707):

This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 439 to 459 amino acids in length. This domain is found associated with and. This domain has two completely conserved residues (P and K) that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3535