The domain within your query sequence starts at position 838 and ends at position 1048; the E-value for the DUF3543 domain shown below is 1.8e-26.

EQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGF
AEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLR
LQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEG
LQHTLTDQADIENIAKCKLCIERRLSALLSG

DUF3543

DUF3543
PFAM accession number:PF12063
Interpro abstract (IPR022708):

This domain belonging to serine/threonine-protein kinases is functionally uncharacterised. This domain is found in eukaryotes. It is typically between 217 to 291 amino acids in length and is found associated with. This domain has a single completely conserved residue A that may be functionally important.

GO function:protein serine/threonine kinase activity (GO:0004674)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3543