The domain within your query sequence starts at position 417 and ends at position 626; the E-value for the DUF3544 domain shown below is 2.6e-102.

KPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKS
TASPASTKTGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTSTTGSILNLNLDRSKAEMDLK
ELSESVQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSE
DSEKSESSDSEYVSDEEQKPKNEPEDPEDK

DUF3544

DUF3544
PFAM accession number:PF12064
Interpro abstract (IPR021931):

Protein kinase C-binding protein 1 (also known as ZMYND8) acts as a transcriptional corepressor of the H3K4 demethylase JARID1D [(PUBMED:27477906)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3544