The domain within your query sequence starts at position 153 and ends at position 262; the E-value for the DUF3546 domain shown below is 3.8e-44.

KEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQE
ARGALQNRLKVFLSLMESGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTE

DUF3546

DUF3546
PFAM accession number:PF12066
Interpro abstract (IPR021933):

This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 93 to 114 amino acids in length. This domain has two completely conserved Y residues that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3546