The domain within your query sequence starts at position 3 and ends at position 217; the E-value for the DUF3548 domain shown below is 8.2e-93.

GSSYRVVFEKGGVYLHTSARKHQDPDSLIAGVIRVVEKDSDVFLHWAPVEEAGDPTQILF
KKDPSRGEPSTSEEEPTFDPGYEPDWAVISTVRPQPHLAEPRKGAEPSSSRSSWAFSVSL
GELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQDSRL
YLVFPQDPSALSDSFHHLQLFDQDSSNVVSRFLQD

DUF3548

DUF3548
PFAM accession number:PF12068
Interpro abstract (IPR021935):

This presumed domain is functionally uncharacterised. This domain is found in eukaryotes and is typically between 184 to 216 amino acids in length. The domain is found associated with and at the N terminus of GYP7 proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3548