The domain within your query sequence starts at position 204 and ends at position 378; the E-value for the DUF3583 domain shown below is 1.2e-10.

LEQAVLAVKALQTATKEAIALLQSMVEEVRHSAAEEEAAIHALFGSMQDRMAERKALLLQ
TVQSQYEEKDKAFKEQLTHLASLLPTLQVHLVICSSFLSLASKAEFLDLGYELMERLQGI
VTRPHRLRPAQSSKIASDHRAEFARCLEPLLLLGPRREVSTVGGANTLSGGSSPM

DUF3583

DUF3583
PFAM accession number:PF12126
Interpro abstract (IPR021978):

This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length. It is found in association with IPR018957 and IPR000315. Most members are promyelocytic leukemia proteins, and this family lies towards the C terminus.

Proteins containing this domain include PML protein from mammals. PML (promyelocytic leukaemia) functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms [(PUBMED:15356634)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3583