The domain within your query sequence starts at position 111 and ends at position 172; the E-value for the DUF3657 domain shown below is 1.9e-19.

LSLGLHFTDGDYSADDLNALQLISSRTLKLHYSICRGLHHHANVMFDYFHLSVVSVTVHA
SL

DUF3657

DUF3657
PFAM accession number:PF12394
Interpro abstract (IPR022122):

This family is found in eukaryotes, and is approximately 60 amino acids in length. Proteins in this family contain a domain found in a group of putative lipases (IPR007751).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3657