The domain within your query sequence starts at position 295 and ends at position 352; the E-value for the DUF3657 domain shown below is 1.2e-7.

SLLMALWGQFLEAITLHEDLRVLLAQEHHTLRVRRFSEAFFCFEHPREAAIAYQELHA

DUF3657

DUF3657
PFAM accession number:PF12394
Interpro abstract (IPR022122):

This family is found in eukaryotes, and is approximately 60 amino acids in length. Proteins in this family contain a domain found in a group of putative lipases ( IPR007751 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3657