The domain within your query sequence starts at position 41 and ends at position 111; the E-value for the DUF3669 domain shown below is 8.1e-10.
LWTVVAAIQAVEKKMESQAARLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGTL LQEYGLLQRRL
DUF3669 |
 |
|---|
| PFAM accession number: | PF12417 |
|---|---|
| Interpro abstract (IPR022137): | This domain family is found in eukaryotes, and is typically between 64 and 80 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3669