The domain within your query sequence starts at position 379 and ends at position 459; the E-value for the DUF3677 domain shown below is 6.4e-37.

LLRLLTATCGYKEVRLLAVQRLEMWLQNPKLTRPAQDLLMSVCMNCNSHGSEDMDVISHL
IKIRLKPKVLLNHYMLCIREL

DUF3677

DUF3677
PFAM accession number:PF12432
Interpro abstract (IPR022145):

This domain of unknown function is found in metazoan proteins. It is found in the subunit 1 of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing [(PUBMED:16239144)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3677