The domain within your query sequence starts at position 407 and ends at position 714; the E-value for the DUF3689 domain shown below is 5.2e-135.

VHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFS
DHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEP
AESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLL
GELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVDMKV
AEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLARRKERLP
LYLRLLQR

DUF3689

DUF3689
PFAM accession number:PF12463
Interpro abstract (IPR022162):

TRPC4AP is a substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control [(PUBMED:20551172)].

GO process:ubiquitin-dependent protein catabolic process (GO:0006511)
GO component:Cul4A-RING E3 ubiquitin ligase complex (GO:0031464)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3689