The domain within your query sequence starts at position 1 and ends at position 92; the E-value for the DUF3694 domain shown below is 4.4e-23.

XAVLSLNIISAKSLKAAHSSSRLLLDKDIPRTFYRFEAVWDSSLHNSLLLNRVTPYGEKI
YMTLSAYLELDHCIQPAVITKDVCMVFYSRDA

DUF3694

DUF3694
PFAM accession number:PF12473
Interpro abstract (IPR022164):

This domain is found in eukaryotes, and is typically between 131 and 151 amino acids in length. There is a single completely conserved residue W that may be functionally important. It is found in some kinesin-like proteins and in Rab GTPase-activating protein 1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3694