The domain within your query sequence starts at position 29 and ends at position 128; the E-value for the DUF3695 domain shown below is 1.5e-33.
SLYKNPAHLAQQQDPWSRLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKN KTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIR
DUF3695 |
---|
PFAM accession number: | PF12494 |
---|---|
Interpro abstract (IPR022179): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 157 and 192 amino acids in length. There is a single completely conserved residue D that may be functionally important. The family includes protein C1orf194 and homologues. C1orf194 has been suggested to be involved in intracellular Ca2 homeostasis [ (PUBMED:31199454) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3695