The domain within your query sequence starts at position 512 and ends at position 544; the E-value for the DUF3697 domain shown below is 1.5e-18.

PASKVPVSAVEMPGSSDVTGLNVQFGALEFGSE

DUF3697

DUF3697
PFAM accession number:PF12478
Interpro abstract (IPR022166):

This domain family is found in eukaryotes, and is approximately 30 amino acids in length. The family is found in association with. There are two conserved sequence motifs: AVEMPG and QFG.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3697